BinaSmart

Name: BinaSmart
Author: BinaSmart

AgentA2AMCP

Ethiopia's all-in-one digital platform, in Amharic and English: fixed-price ride-hailing and shared commute in Addis Ababa, a directory of buildings, hotels, hospitals and shops, events and films, and 24 Digital Ethiopia guides. Agents reach it over MCP.

by BinaSmartrepository ↗homepage ↗v1.0.0

Is this yours?

This record is unclaimed

Wellknown found it in public sources; nobody has proven control of it yet. Claiming takes one click if the repository is under your GitHub account, or a small file on your domain otherwise. Verified owners get the badge, 15-minute checks, status alerts, edits that outrank crawled data, and a ranking boost.

Agents can do it too: POST https://wellknown.network/api/v1/claims with {"agent":"binasmart","method":"well_known_file"} — machine-readable steps at claim.json, guide at /docs/claim.

Claim this record

Observed by Wellknown

Evidence

Everything here was measured by our prober or read from a registry. Nothing is self-reported.

30-day availability110/110 checks ok

Tools observed via MCP handshake

quote_ride — Fixed upfront price for a ride inside Addis Ababa, Ethiopia — no surge, cash or telebirr/Chapa. Returns distance, ETA and the fare for every vehicle tier (moto,
request_ride — Books a ride in Addis Ababa at the fixed fare from quote_ride. It sends a real driver, so it takes the pickup, drop-off, tier, fare and the rider's Ethiopian ph
get_ride_status — Current status of a BinaSmart ride (dispatching, assigned, arriving, arrived, ontrip, completed, cancelled) with driver name, vehicle and plate once assigned. N
cancel_ride — Cancels a BinaSmart ride that has not started yet. A cancellation cannot be undone. Needs the ride id and the rider phone used to book.
search_places — Find buildings, hotels, hospitals and shops in Addis Ababa listed on BinaSmart (bina.et): cafés, restaurants, pharmacies, banks, gyms, salons, clinics, offices.
list_events — Upcoming films, concerts, theatre and events on BinaSmart in Addis Ababa with venue, hall, start time, prices per tier and seats left. Seats are chosen and paid
list_films — Licensed Amharic (Ethiopian) films that can be watched online on BinaSmart Watch (bina.et/watch): title in Amharic and English, year, genre, whether it is free
get_hotel_rooms — Room types, nightly prices (ETB), capacity and amenities for a hotel listed on BinaSmart. Use the slug from search_places (is_hotel = true).
get_hospital_departments — Departments of a hospital listed on BinaSmart with consultation fee (ETB), doctors, hours, floor/room and appointment slots left for a date. Use the slug from s
list_overseas_agencies — Ethiopian agencies that send domestic workers to GCC countries, approved on BinaSmart/GCC Domestic: name, licence, whether it is in the Ministry of Labor and Sk
get_ethiopia_guide — BinaSmart's bilingual (Amharic + English) step-by-step guides to Ethiopian government and banking services: Fayda ID, telebirr, CBE Birr, e-Passport, eVisa, TIN
search_knowledge — Semantic search over BinaSmart's knowledge base: every service (BinaRide, BinaPool shared commute, Bina Airport, hotels, cinema, BinaWatch, insurance, flights,
list_pool_corridors — BinaPool (ጋራ ጉዞ) is BinaSmart's shared commute in Addis Ababa: up to four riders share one Comfort car and pay per seat. Lists the corridors open right now (Meg
find_pool_groups — Cars currently filling within about 2.5 km of a point in Addis Ababa: destination, seats left, seat price, women-only flag, and a share url (https://bina.et/poo
list_tenders — Public tender and procurement notices in Ethiopia listed on BinaSmart (bina.et/tenders): the issuing organisation, what is wanted, the deadline and days left, b
get_tender — The full text of a single tender notice on BinaSmart, by its slug from list_tenders: requirements, bid bond, where and when to submit, and the link to the origi
list_tender_categories — The categories of tender open on BinaSmart right now and how many are in each — useful before calling list_tenders with a category filter.
list_news — Recent articles from BinaSmart news (bina.et/news), mostly in Amharic: technology, business, law, real estate, construction and employment in Ethiopia. Returns
get_news_article — The full text of a single BinaSmart news article by its slug from list_news.
list_jobs — Open job vacancies in Ethiopia listed on BinaSmart (bina.et/jobs): the job title, the company posting it, the city, the deadline and days left, salary and requi
get_job — The full advert for a single vacancy on BinaSmart, by its slug from list_jobs: the duties and requirements as the employer wrote them, how to apply, and the com
list_job_fields — The fields of work with open vacancies on BinaSmart right now and how many are in each, plus the cities hiring most — useful before calling list_jobs with a fie
get_employer — A company listed on BinaSmart: what it does, its address and location when we hold them, and every vacancy it has posted. By employer slug from list_jobs or get
search_properties — Live listings on bina.et/property from Addis Ababa real-estate companies' own websites, checked every week: title, price as the company wrote it (some per m² or
search_cars — Live new and used cars on bina.et/cars from Addis Ababa dealers' and car markets' own websites, checked every week: make, model, year, price, mileage, fuel, gea
search_hotels — Hotels, guest houses, pensions, hostels and furnished apartments in Addis Ababa from BinaSmart's directory (1,000+ places from the city map): name, type, sub-ci
search_health — Find hospitals, clinics, dentists, laboratories, health centres and doctors in Addis Ababa from BinaSmart Health (bina.et/health, 250+ places from the city map
search_restaurants — Restaurants, cafés and fast-food places in Addis Ababa from BinaSmart Restaurants (bina.et/restaurants, about 890 places from the city map plus what restaurants
search_pharmacies — Pharmacies in Addis Ababa from BinaSmart Health (bina.et/health, about 1,700 pharmacies from the Ministry of Health registry and the city map). Search by name o
search_companies — Companies listed on BinaSmart (bina.et/companies): real-estate developers, car sellers, domestic-worker agencies and other employers, with sub-city, website, wh
list_cinema_showtimes — What is showing in Addis Ababa cinemas this week, from BinaSmart Cinema (bina.et/cinema): each cinema with its address and phone, and each film with its show ti
list_tv_and_radio — Ethiopian TV channels and radio stations on BinaWatch (bina.et/watch): whether each is live right now with the live programme title and link, its newest videos,
list_tv_series — Ethiopian TV drama and comedy series on BinaWatch (bina.et/watch) with the channel that airs them and their newest episodes (title, date and watch link). Search

Declared by sources

What the publisher says

Attributed to the source that supplied each field. Treated as claims, not facts.

No long description beyond the summary.

transportride-hailingaddis-ababaethiopiacarpoolcommutedirectoryplaceshotelshospitalscinemaeventsticketsfilmguidesgovernmentknowledge-baseamharic

Declared skills

Fixed-price rides in Addis Ababa — Quote a fare, book a ride, check its status or cancel it. Fares are fixed at quote time — no surge. Moto, bajaj, economy, comfort and XL. Addis Ababa only.
BinaPool shared commute — Corridors open now with their stops and live per-seat price ladder, and cars filling near a point — seats left, price, women-only groups.
Places in Addis Ababa — Buildings, hotels, hospitals and shops — cafés, restaurants, pharmacies, banks, gyms, salons, clinics and offices — with hotel room types and hospital departments.
Films and events — Upcoming films, concerts, theatre and events on sale with venue, start time, prices per tier and seats left, plus Amharic films to watch online.
Digital Ethiopia guides and knowledge — Semantic search over every BinaSmart service and its rules, practical Addis Ababa knowledge, and 24 step-by-step guides — Fayda, telebirr, TIN, VAT, eVisa, driving licence and more. Answers carry a source url to cite.

kind A2A Agent Card

name A2A Agent Card

repoUrl Official MCP Registry

summary A2A Agent Card

version A2A Agent Card

description A2A Agent Card

homepageUrl A2A Agent Card

publisherUrl A2A Agent Card

publisherName A2A Agent Card

Provenance

Where this record came from

Every source is kept verbatim. Field changes are logged as events.

A2A Agent Cardhttps://bina.et/.well-known/agent-card.json

first seen 1 mo ago · fetched 4 d agoopen ↗

Official MCP Registryet.bina/binasmart

first seen 2 mo ago · fetched 4 d agoopen ↗

Field history (12 recent events)

16 d ago · declared · repoUrl → "https://github.com/akembalo-svg/binasmart-mcp"
1 mo ago · declared · kind → "agent"
1 mo ago · declared · summary → "Ethiopia's all-in-one digital platform, in Amharic and English: fixed-price ride-hailing and shared commute in Addis Ab
1 mo ago · declared · description → "Ethiopia's all-in-one digital platform, in Amharic and English: fixed-price ride-hailing and shared commute in Addis Ab
1 mo ago · declared · publisherName → "BinaSmart"
1 mo ago · declared · publisherUrl → "https://bina.et"
1 mo ago · declared · protocols → ["a2a","mcp"]
2 mo ago · declared · description → "Quote and book fixed-price rides in Addis Ababa, search the BinaSmart directory and Ethiopia guides"
2 mo ago · declared · publisherName → "et.bina"
2 mo ago · declared · homepageUrl → "https://bina.et/mcp"
2 mo ago · declared · version → "1.0.0"
2 mo ago · declared · protocols → ["mcp"]

when	check	result	http	latency	detail
3 h ago	mcp initialize	ok	200	287 ms	server binasmart 1.4.2 · protocol 2025-06-18 · 33 tools
11 h ago	mcp initialize	ok	200	166 ms	server binasmart 1.4.2 · protocol 2025-06-18 · 33 tools
20 h ago	mcp initialize	ok	200	56 ms	server binasmart 1.4.2 · protocol 2025-06-18 · 33 tools
29 h ago	mcp initialize	ok	200	58 ms	server binasmart 1.4.2 · protocol 2025-06-18 · 33 tools
2 d ago	mcp initialize	ok	200	1107 ms	server binasmart 1.4.2 · protocol 2025-06-18 · 33 tools
2 d ago	mcp initialize	ok	200	120 ms	server binasmart 1.4.2 · protocol 2025-06-18 · 33 tools
2 d ago	mcp initialize	ok	200	80 ms	server binasmart 1.4.2 · protocol 2025-06-18 · 33 tools
2 d ago	mcp initialize	ok	200	64 ms	server binasmart 1.4.2 · protocol 2025-06-18 · 33 tools
2 d ago	mcp initialize	ok	200	108 ms	server binasmart 1.4.2 · protocol 2025-06-18 · 33 tools
3 d ago	mcp initialize	ok	200	89 ms	server binasmart 1.4.0 · protocol 2025-06-18 · 33 tools

This record is unclaimed

Evidence

What the publisher says

Capabilities

Where this record came from