Every change Wellknown observed on this MCP server, newest first, with what it was before and what it became. Tool-surface changes carry the definition diff. Nothing here is edited after the fact.
Certificate recorded, valid to 2026-11-29
Authorization not required
Changed the definition of "get_anae_activity" and "search_anae_activities"
⟨39 unchanged words⟩ an error when the code does not exist. In Algeria an activity that has a regime of its own carries the optional object regime, present only then and today only for 080101, micro-importation: note (the facts in French, Arabic and English: who may import, at most 1,800,000 DZD of goods per trip and two trips a month, the card and the general authorisation of the Ministry of Foreign Trade, the conditions, the advantages, the obligations, the exclusions), legal_reference (executive decree n° 25-170 of 28 June 2025, JO n° 40 of 2025) and source_url (the Journal Officiel PDF). That activity is NOT governed by the ordinary auto-entrepreneur limits: never present the 5 million DZD yearly turnover ceiling of the ordinary status as its limit, and read regime.note before answering about it. For Tunisia (country TN) pass the key ⟨137 unchanged words⟩
⟨52 unchanged words⟩ and domain. meta.total is the number of matches. In Algeria an activity that has a regime of its own, today 080101 (micro-importation), also carries the object regime: read it before answering about that activity, it is not the ordinary auto-entrepreneur regime (see get_anae_activity). For Morocco (country MA) the status is ⟨146 unchanged words⟩
Changed the definition of "calculate_casnos", "calculate_ifu", "customs_tariff_chapters" and 6 more
⟨153 unchanged words⟩ of ten classes; the revenue is not used.TheOther Tunisianflat taxself-employedcalculatorschemes (calculate_ifuagricultural, fishing, craftsmen)isarenotregimesavailableofyet.the same tool, and the Tunisian flat tax is calculate_ifu.
Unknown → Live
First tool surface recorded: 19 tools (server version 1.2.0)
https://www.upgrowth.dz/mcp (mcp_streamable_http) — from mcp_registry, with the record
Showing the latest 7 events. The API returns up to 500 and filters by kind: ?kind=tool_surface_changed
{"additionalProperties":false,"properties":{"annual_hours":{"description":"Morocco only (country MA): the normal yearly working time in hours used with minimum_wage_hourly; 2,288 (article 184 of the Labour Code, not read in the decrees) when left out.","maximum":8760,"minimum":1,"type":"integer"},"category":{"description":"Morocco only (country MA), regime TRAVAILLEUR_NON_SALARIE: the category of non-salaried worker, for example doctor, dentist, pharmacist, notary, architect, veterinarian, land_surveyor, judicial_bailiff, taxi_driver, professional_driver, farmer, trader_artisan_accounting, artisan_unaccounted, traditional_fishing_boat_owner, cpu. Leave it out to list the categories, each with its decree and its Bulletin officiel.","type":"string"},"country":{"default":"DZ","description":"Country of ⟨147 unchanged words⟩ ,"en"],"type":"string"},"regimeminimum_wage_hourly":{"description":"AlgeriaMorocco only (country MA), regime TRAVAILLEUR_NON_SALARIE: thetaxlegalregimehourly minimum wage of non-agricultural activities in dirhams, which thepersondecrees do not state. With it the answer gives the forfait income in dirhams (multiplier times that wage times the yearly hours).","maximum":10000,"minimum":0,"type":"number"},"net_profit":{"description":"MoroccoFORFAITAIRE_ACHAT_VENTEonly (flat-ratecountry MA), category trader_artisan_accounting under the actual net result regime: the annual net profit in dirhams,purchasewhichandpicksresalethe tier (up to 100,000 dirhams or above).","maximum":1000000000000,"minimum":0,"type":"number"},"regime":{"description":"Algeria: FORFAITAIRE_ACHAT_VENTE, FORFAITAIRE_PRESTATIONS (flat-rateregimeregimes, resale and services), BENEFICE_REEL (actual-profitactualregimeprofit), AUTO_ENTREPRENEUR (theflat yearly optionof the auto-entrepreneur status) or PREMIERE_ANNEE (first year). Tunisia (country TN): INDEPENDANT_NON_AGRICOLE, INDEPENDANT_AGRICOLE and ARMATEUR_PECHE_30T (ten classes, need income_class); PETIT_AGRICULTEUR, PETIT_ARMATEUR_PECHE and PECHEUR_INDEPENDANT (flat 7.5 % scheme ofcontributionlaw 2002-32); ARTISAN (craftsmen of the same law,with7.5no%previousofyear2/3toofrelytheonSMIG over 200 hours a month).TunisiaMorocco (countryTNMA):only INDEPENDANT_NON_AGRICOLE,AUTO_ENTREPRENEURthe(decreeCNSS2-21-928)schemeorofTRAVAILLEUR_NON_SALARIE (theself-employedother non-salaried workers:ofonethedecreenon-agriculturalpersectorcategory,which alsochosenneedswithincome_class.category).","enum":["FORFAITAIRE_ACHAT_VENTE","FORFAITAIRE_PRESTATIONS","BENEFICE_REEL","AUTO_ENTREPRENEUR","PREMIERE_ANNEE","INDEPENDANT_NON_AGRICOLE","INDEPENDANT_AGRICOLE","ARMATEUR_PECHE_30T","PETIT_AGRICULTEUR","PETIT_ARMATEUR_PECHE","PECHEUR_INDEPENDANT","ARTISAN","TRAVAILLEUR_NON_SALARIE"],"type":"string"},"revenue":{ ⟨42 unchanged words⟩ ), whose contribution depends on the income class. For Morocco (country MA, regime AUTO_ENTREPRENEUR) it is required: the yearly amount, in Moroccan dirhams (MAD), of the \"droits annuels\" that select the bracket of the scale of the tax administration.","maximum":1000000000000,"minimum":0,"type":"number"},"seniority_years":{"description":"Morocco only (country MA): the seniority in years, which picks the tier of the categories whose forfait income depends on it (dentist, veterinarian, land_surveyor, architect). Complete years count.","maximum":100,"minimum":0,"type":"number"},"smig_monthly_tnd":{"description":"Tunisia only (country TN): the monthly guaranteed minimum wage (SMIG) in dinars, for the craftsmen of the law no. 2002-32 (regime ARTISAN of calculate_casnos, activity crafts of calculate_ifu): their contribution is 7.5 % of two thirds of its hourly value (monthly amount divided by 208 hours at 48 hours a week) over 200 hours a month. Leave it out to use the SMIG of décret 2026-67 (554.736 dinars, 48 hour week; see week_hours).","maximum":100000,"minimum":0,"type":"number"},"tier":{"description":"Morocco only (country MA): the tier of the category when it has several (for example general or specialist for a doctor, owner or non_owner for a driver, class_1 to class_9 for a farmer, simplified for a trader under the simplified net result regime). The answer lists the tiers of the category.","type":"string"},"week_hours":{"default":48,"description":"Tunisia only (country TN): the weekly working-time regime whose SMIG of décret 2026-67 the craftsmen's contribution uses when smig_monthly_tnd is left out: 48 (554.736 dinars a month, the default) or 40 (470.251). The CNSS page of the craftsmen uses the 48 hour regime, so leave it at 48.","enum":[40,48],"type":"integer"},"year":{"default":2026,"description ⟨27 unchanged words⟩
⟨159 unchanged words⟩ July 2002 (crafts), the social partandis 7.5 % of two thirds of thetotalhourlyareSMIGnull.overThe200generalhoursregimeaandmonththe(SMIG of décret 2026-67, or smig_monthly_tnd). Tunisia also serves regime forfait (option, zone, rural) and regimearegeneralnot(net_income:servedtheforincomeTunisia.tax scale). Tunisia needs an API key. For Morocco ( ⟨56 unchanged words⟩
⟨51 unchanged words⟩ 23 July 2002, whose social part isnottwocalculated.thirds of the SMIG at 7.5 % (week_hours, smig_monthly_tnd). For Morocco (country MA) it is required ⟨127 unchanged words⟩ ,"en"],"type":"string"},"net_income":{"description":"Tunisia only (country TN), required with regime general: the net taxable income in Tunisian dinars, after the deductions of the code. The scale of article 44 of the income tax code is applied to it; the turnover only serves the minimum tax.","maximum":1000000000000,"minimum":0,"type":"number"},"option":{"default":"standard","description":"Tunisia only (country TN), regime forfait: standard for the tariff of article 44 ter (400 dinars in a communal zone, 200 elsewhere, up to 10,000 dinars of turnover, then 3 %) or optional for the optional forfait tax of paragraph 1 (4,000 dinars up to 50,000 of turnover, 5,000 dinars up to 100,000).","enum":["standard","optional"],"type":"string"},"regime":{"description":"ae for the auto-entrepreneur status (ANAE), general for the general IFU regime of the other micro-businesses. Tunisia (country TN): ae (single contribution), forfait (forfait tax of article 44 ter of the income tax code, with option and zone) or general (the income tax scale of article 44 applied to net_income).","enum":["ae","general","forfait"],"type":"string"},"rural":{"description":"Tunisia only (country TN), regime forfait with option optional: true for a person working in the rural zones and the villages, who pays half the amount.","type":"boolean"},"smig_monthly_tnd":{"description":"Tunisia only (country TN): the monthly guaranteed minimum wage (SMIG) in dinars, for the craftsmen of the law no. 2002-32 (regime ARTISAN of calculate_casnos, activity crafts of calculate_ifu): their contribution is 7.5 % of two thirds of its hourly value (monthly amount divided by 208 hours at 48 hours a week) over 200 hours a month. Leave it out to use the SMIG of décret 2026-67 (554.736 dinars, 48 hour week; see week_hours).","maximum":100000,"minimum":0,"type":"number"},"
⟨35 unchanged words⟩ TN (French titles; needs an API key) and for Morocco with country MA (harmonized system 2022, French titles; needs an API key). This dataset holds no duty rates and ⟨7 unchanged words⟩
⟨74 unchanged words⟩ (douane.gov.tn); Tunisia needs an API key. For Morocco (country MA) it lists the 21 sections of the harmonized system 2022 in French (the ADII tariff adopts it; MA needs an API key). This dataset holds no duty rates and no ⟨6 unchanged words⟩
⟨106 unchanged words⟩ French, its section, division and group,theits statusnot_determined(reglementeeandwith theofficialauthorisationssource;oftheannexauthority,1authorizationof décret 2018-417 that govern it andlegaltheirreferencelegalfieldsreferences,areornulllibre because that list is exclusive) and theNATofficialholdssource.none.Pass A1-017 or A2-005 to get one authorisation of the decree as a record. For Morocco (country MA) pass the four-digit ⟨17 unchanged words⟩
⟨23 unchanged words⟩ code, four digits, for example 0111 or01.11.01.11, or the code of an authorisation of décret 2018-417, A1-017 (annex 1) or A2-005 (annex 2), or one added by décret 2022-317 such as A1-019bis. Morocco (country MA): the NMA 2010 activity ⟨16 unchanged words⟩ 6}|[0-9]{2}\\.[0-9]{2}|[Aa][12]-[0-9]{1,3}([Bb][Ii][Ss])?)$","type":"string"},"country" ⟨112 unchanged words⟩
⟨76 unchanged words⟩ ): you get its publication date, thelinklinks to its Frencheditionand Arabic editions and, in data.supplements, the supplements of that ⟨82 unchanged words⟩
⟨59 unchanged words⟩ its number, its publication date and thelinklinks to its Frencheditionand Arabic editions onsgg.gov.ma;sgg.gov.ma (editions.fr and editions.ar, each with available true or false and pdf_url); a supplement (bis, ter) is listed ⟨116 unchanged words⟩
⟨81 unchanged words⟩ Moroccan official gazette, from 1912: its FrencheditionandonlyArabic editions (theArabicFrencheditiontranslationiseditionnotholdsindexedfeweryetissues) and no summaries. For Tunisia (country TN ⟨70 unchanged words⟩
⟨148 unchanged words⟩ list of activities that need an authorization:no officialthetextstatusreadcomessofromfarasayshand-reviewedwhichmap of itscodesclassesaretofree,theregulatedauthorisationsorofclosedannex 1 of décret 2018-417,sotheeveryexclusiveTunisianlistcode(reglementeehaswith thestatusauthorisationsnot_determinedand their legal references, libre because the list is exclusive), never libre bydefault.default: without the map the status is not_determined. With list=authorisations it searches the authorisations themselves. Tunisia needs an API key. For Morocco ( ⟨84 unchanged words⟩
⟨142 unchanged words⟩ "minimum":1,"type":"integer"},"list":{"default":"nat","description":"Tunisia only (country TN): nat (the default) searches the classes of the NAT 2009; authorisations searches the 100 authorisations of annex 1 (and the 27 of annex 2, those to be struck out) of décret gouvernemental n° 2018-417 of 11 May 2018, as records with their conditions, procedures, delays and legal references. Ignored for Algeria and Morocco. Get one with get_activity_code and a code such as A1-017.","enum":["nat","authorisations"],"type":"string"},"offset":{"default":0,"description":"Number ⟨247 unchanged words⟩ trade register). For Tunisia (country TN):everyreglementeecodewhenhasantheauthorisationstatusofnot_determined,annexwhich1isofalsodécretaccepted2018-417