CADLens

Name: CADLens
Author: CADLens

AgentA2A

Parses DWG, DXF, DWF, and DGN V7 drawings into structured vector JSON, layer metadata, drawing metadata, and PNG preview images. Send a CAD file as a file part and CADLens returns a task you can poll for the parsed result.

by CADLenshomepage ↗v1.0.0

Is this yours?

This record is unclaimed

Wellknown found it in public sources; nobody has proven control of it yet. Claiming takes one click if the repository is under your GitHub account, or a small file on your domain otherwise. Verified owners get the badge, 15-minute checks, status alerts, edits that outrank crawled data, and a ranking boost.

Agents can do it too: POST https://wellknown.network/api/v1/claims with {"agent":"cadlens","method":"well_known_file"} — machine-readable steps at claim.json, guide at /docs/claim.

Claim this record

Observed by Wellknown

Evidence

Everything here was measured by our prober or read from a registry. Nothing is self-reported.

30-day availability113/113 checks ok

when	check	result	http	latency	detail
2 h ago	a2a card	ok	200	246 ms	protocol 1.0 · card: CADLens · 4 skills
8 h ago	a2a card	ok	200	243 ms	protocol 1.0 · card: CADLens · 4 skills
15 h ago	a2a card	ok	200	236 ms	protocol 1.0 · card: CADLens · 4 skills
22 h ago	a2a card	ok	200	199 ms	protocol 1.0 · card: CADLens · 4 skills
29 h ago	a2a card	ok	200	193 ms	protocol 1.0 · card: CADLens · 4 skills
35 h ago	a2a card	ok	200	291 ms	protocol 1.0 · card: CADLens · 4 skills
2 d ago	a2a card	ok	200	192 ms	protocol 1.0 · card: CADLens · 4 skills
2 d ago	a2a card	ok	200	209 ms	protocol 1.0 · card: CADLens · 4 skills
2 d ago	a2a card	ok	200	237 ms	protocol 1.0 · card: CADLens · 4 skills
3 d ago	a2a card	ok	200	181 ms	protocol 1.0 · card: CADLens · 4 skills

Declared by sources

What the publisher says

Attributed to the source that supplied each field. Treated as claims, not facts.

No long description beyond the summary.

caddwgdxfdwfparsingvectorlayersmetadatapreviewpngrenderunitsextents

Declared skills

Parse CAD file — Parse a DWG, DXF, DWF, or DGN V7 drawing into structured vector JSON: entities with coordinates, layers, blocks, text, and drawing metadata.
Extract CAD layers — Return the layer table of a drawing — layer names, colors, line types, and per-layer entity counts.
Render CAD preview image — Render a PNG preview of a drawing and return a time-limited URL to the image.
Read drawing metadata — Report a drawing’s units, extents, bounding box, CAD version, sheet list, and entity counts by type.

kind A2A Agent Card

name A2A Agent Card

summary A2A Agent Card

version A2A Agent Card

description A2A Agent Card

homepageUrl A2A Agent Card

publisherUrl A2A Agent Card

publisherName A2A Agent Card

Provenance

Where this record came from

Every source is kept verbatim. Field changes are logged as events.

A2A Agent Cardhttps://cadlens.co/.well-known/agent-card.json

first seen 2 mo ago · fetched 5 d agoopen ↗

Field history (7 recent events)

2 mo ago · declared · summary → "Parses DWG, DXF, DWF, and DGN V7 drawings into structured vector JSON, layer metadata, drawing metadata, and PNG previe
2 mo ago · declared · description → "Parses DWG, DXF, DWF, and DGN V7 drawings into structured vector JSON, layer metadata, drawing metadata, and PNG previe
2 mo ago · declared · publisherName → "CADLens"
2 mo ago · declared · publisherUrl → "https://cadlens.co"
2 mo ago · declared · homepageUrl → "https://cadlens.co/docs"
2 mo ago · declared · version → "1.0.0"
2 mo ago · declared · protocols → ["a2a"]

This record is unclaimed

Evidence

What the publisher says

Capabilities

Where this record came from