AIsa

Name: AIsa
Author: AIsa

AgentA2A

Capability layer for the agentic economy. Models, skills, payments, and deployment — everything AI agents need to reason, act, and transact.

by AIsahomepage ↗v1.0.0

Is this yours?

This record is unclaimed

Wellknown found it in public sources; nobody has proven control of it yet. Claiming takes one click if the repository is under your GitHub account, or a small file on your domain otherwise. Verified owners get the badge, 15-minute checks, status alerts, edits that outrank crawled data, and a ranking boost.

Agents can do it too: POST https://wellknown.network/api/v1/claims with {"agent":"aisa-aisa","method":"well_known_file"} — machine-readable steps at claim.json, guide at /docs/claim.

Claim this record

Observed by Wellknown

Evidence

Everything here was measured by our prober or read from a registry. Nothing is self-reported.

30-day availability0/3 checks ok

30 days ago

Endpoints

https://api.aisa.onea2a · auth: none · checked on a schedule

Registry facts

Not distributed through a package registry we index.

when	check	result	http	latency	detail
2 h ago	a2a card	failed	404	175 ms	http 404
27 h ago	a2a card	failed	404	171 ms	http 404
2 d ago	a2a card	failed	404	163 ms	http 404

Declared by sources

What the publisher says

Attributed to the source that supplied each field. Treated as claims, not facts.

No long description beyond the summary.

inferencellmai-modelstext-generationchatopenai-compatibleseokeyword-researchdataforseomarketingserpkolinfluencer-marketingcreator-discoveryemail-lookupoutreachforecastprediction-marketstwitternewsfinancetrend-analysissocial-mediaxsearchautomationpostingstocksequitiesmarket-datasec-filingsearningscryptocoingeckopriceschartsexchangespolymarketkalshitrading

Declared skills

AI Model Inference — Access 50+ LLMs from OpenAI, Anthropic, Google, DeepSeek, and more via an OpenAI-compatible /v1/chat/completions endpoint. Supports text, vision, coding, reasoning, creative writing, and translation models.
SEO Keyword Research — Build SEO keyword strategies from a site, product, market, or competitor set with crawl context, DataForSEO metrics, SERP evidence, and AIsa LLM clustering.
KOL Creator Discovery — Turn one YouTube, TikTok, or Instagram creator profile into an outreach-ready list with verified contact emails and closely matched creators.
Trend Forecast — Forecast trends by combining prediction markets, X/Twitter sentiment, news velocity, financial market data, and LLM synthesis.
Twitter Autopilot — Twitter/X intelligence and automation for autonomous agents. Read, search, engage, write, and post (text & media) on Twitter/X.
MarketPulse — Query real-time and historical financial data for equities — prices, news, financial statements, metrics, analyst estimates, insider/institutional activity, SEC filings, earnings press releases, segmented revenues, stock screening, and macro interest rates.
Crypto Market Data — Real-time and historical cryptocurrency market data via CoinGecko: prices, market-cap rankings, charts, OHLC candles, token lookup, exchanges, categories, trending searches, and news.
Prediction Market Data — Prediction markets data — Polymarket, Kalshi markets, prices, positions, and trades.
Prediction Market Arbitrage — Find and analyze arbitrage opportunities across prediction markets.
Multi-source Search — Intelligent search for autonomous agents with structured retrieval plus Perplexity Sonar answer endpoints.
Perplexity Search — Perplexity Sonar search and answer generation through AIsa.
YouTube SERP — YouTube SERP for autonomous agents. Search top-ranking videos, channels, and trends.
Media Gen — Generate images & videos with a single AIsa API key. 4 image models across 3 endpoints, 4 Wan video variants.

kind A2A Agent Card

name A2A Agent Card

summary A2A Agent Card

version A2A Agent Card

description A2A Agent Card

homepageUrl A2A Agent Card

publisherUrl A2A Agent Card

publisherName A2A Agent Card

Provenance

Where this record came from

Every source is kept verbatim. Field changes are logged as events.

A2A Agent Cardhttps://aisa.one/.well-known/agent-card.json

first seen 2 d ago · fetched 2 d agoopen ↗

Field history (7 recent events)

2 d ago · declared · summary → "Capability layer for the agentic economy. Models, skills, payments, and deployment — everything AI agents need to reaso
2 d ago · declared · description → "Capability layer for the agentic economy. Models, skills, payments, and deployment — everything AI agents need to reaso
2 d ago · declared · publisherName → "AIsa"
2 d ago · declared · publisherUrl → "https://aisa.one"
2 d ago · declared · homepageUrl → "https://aisa.one/docs"
2 d ago · declared · version → "1.0.0"
2 d ago · declared · protocols → ["a2a"]

Last 30 Days — Multi-source research brief covering the last 30 days. Aggregates web, news, social, and financial signals into a single report.

AIsa Provider for OpenClaw — Configure OpenClaw to use AIsa as its model provider for Chinese and global LLM workflows.

AIsa Tavily Search — Search the web and extract public page content for source discovery, current news lookup, and research workflows.

AIsa Twitter API Command Center — Search, monitor, and post on X/Twitter through read, OAuth, and approved publishing workflows.

AIsa Twitter Command Center — Search X/Twitter profiles, timelines, tweets, trends, lists, communities, and Spaces for social research.

AIsa Twitter Post Engage — Search X/Twitter and perform approved posting, liking, following, and unfollowing workflows.

AIsa YouTube Search — Search YouTube videos, channels, and playlists for video research and discovery.

AIsa CN-LLM — Route Chinese-language prompts to Chinese LLMs such as Qwen, DeepSeek, GLM, and Baichuan.

Last 30 Days ZH — Research the last 30 days of signals across web, X, YouTube, Polymarket, and social sources in Chinese workflows.

AIsa LLM Router — Route prompts across GPT, Claude, Gemini, Qwen, DeepSeek, Grok, and other supported models.

AIsa Market — Retrieve stock, crypto, financial statement, news, analyst, insider, and macro market data for analysis.

AIsa Multi-Source Search — Search across web, academic, smart search, Tavily, and research-answer sources for stronger coverage.

AIsa Perplexity Deep Research — Generate citation-backed research answers using Perplexity Sonar models.

Prediction Market Arbitrage ZH — Find cross-platform prediction market price differences and potential arbitrage opportunities.

Prediction Market Data ZH — Query Polymarket and Kalshi prices, order books, positions, trades, and wallet metrics.

AIsa Scholar Search — Search academic papers and scholarly sources for research tasks.

AIsa Smart Search — Run hybrid search that combines web and scholarly sources for broader research coverage.

Stock & Crypto Analysis — Analyze stocks and crypto assets with scoring, risk flags, entry levels, targets, and stop levels.

Dividend Analysis — Analyze dividend yield, payout safety, growth, income quality, and dividend track records.

Hot Scanner — Find high-momentum stocks and crypto assets, market movers, catalysts, and watchlist candidates.

Portfolio Management — Track portfolio positions, allocation, and live profit and loss for stocks and crypto assets.

Rumor Scanner — Scan for early market signals such as M&A rumors, insider activity, analyst changes, and regulatory news.

Watchlist Management — Manage a stock and crypto watchlist with price targets, stops, and alert checks.

AIsa Tavily Extract — Extract clean readable content from public URLs for article, document, and source analysis.

AIsa Tavily Search — Search the web with configurable depth, topic filters, time ranges, and domain filters.

AIsa Twitter Command Center — Search X/Twitter and publish approved posts through OAuth-backed workflows.

US Stock Analyst — Create US stock analysis reports using financial data, news, filings, sentiment, and AI synthesis.

AIsa Web Search — Search current web sources and return structured results with titles, URLs, and snippets.

X Intelligence Automation — Search X/Twitter and run approved engagement workflows for likes, follows, unfollows, and posts.

YouTube Search — Search YouTube videos, channels, and playlists for content research, trend discovery, competitor tracking, and topic exploration.

This record is unclaimed

Evidence

What the publisher says

Capabilities

Where this record came from